PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA3G00067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 731aa    MW: 82712.6 Da    PI: 7.1695
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA3G00067genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.51.3e-23149250199
                EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++ l+
  AA3G00067 149 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGKNGVLR 244
                88****************************9643..445569************************************************..3488999* PP

                EEEE-S CS
         B3  94 vkvfrk 99 
                v+v+r+
  AA3G00067 245 VGVRRA 250
                ***997 PP

2Auxin_resp88.99.6e-303193812083
  Auxin_resp  20 stseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  ts+F+++++k+++a+++kvsvGmRfkm+fe+eds+err+sGtv+g++d++p +W++SkWr+L+
   AA3G00067 319 RTSQFIISLNKYLEAMNNKVSVGMRFKMRFEGEDSPERRFSGTVIGLNDCSP-HWKESKWRCLE 381
                 58**************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.4E-41140264IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.36E-38142277IPR015300DNA-binding pseudobarrel domain
CDDcd100173.80E-20147249No hitNo description
PROSITE profilePS5086312.478149251IPR003340B3 DNA binding domain
PfamPF023621.9E-21149250IPR003340B3 DNA binding domain
SMARTSM010197.2E-23149251IPR003340B3 DNA binding domain
PfamPF065076.5E-25320380IPR010525Auxin response factor
PfamPF023091.1E-6592646IPR033389AUX/IAA domain
SuperFamilySSF542771.83E-12606686No hitNo description
PROSITE profilePS5174524.346610691IPR000270PB1 domain
PfamPF023091.7E-5656693IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MANREGEENL YDELWKLCAG PLVDVPKPGE RVYYFPQGHM EQVISLSHHP RFFSRESKFD  60
SEKFSYTFLL LAAFQLEAST NQDLNQMKPL FDLPPKILCR VMNVHLQAEK DTDEVYAQIT  120
LIPEGTQVDE PTSPDPCRPE EQRPTVHSFS KVLTASDTST HGGFSVLRKH ATECLPPLDM  180
TQQTPTQELV AEDLHGYEWR FKHIFRGQPR RHLLTTGWST FVTSKRLVAG DTFVFLRGKN  240
GVLRVGVRRA THQQSNMPSS VISSHSMHLG VLATAFHSTQ SQTRFTVYYK PRYNVCYSTK  300
TSVMSFFFLC SCFGLGLIRT SQFIISLNKY LEAMNNKVSV GMRFKMRFEG EDSPERRFSG  360
TVIGLNDCSP HWKESKWRCL EVHWDDPASI SRPNKVSPWE IEPFVPSSNI PQSSMLKNKR  420
PRQVSEVSGL GTTQSNRLFL TIRSLLVTSI SHTFSHVQYI GSIASNLWSS TLTHSQEFAH  480
SCITSQRSYP QHSYHDDATE DTKGAPGWLM SYSVPATPKM TKDVTPVEEK LPEATTSCRL  540
FGIDLITHSS PLATPKEKTD PIRPIDVSKP TPKADSDQKS EISKISEEKK DEHIQASPKE  600
VQSKQSSSSR SRTKVHMQGV AVGRAVDLTT LDGYNALIDE LEKLFDINGE LRTRNQWEIL  660
FTDDEGDMML VGDDPWPEFC NMVKRIFICS KEDVKKMSSG NKLQVLFSEG EATLTTTVLT  720
SHDVKTDNVL N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-153840417355Auxin response factor 1
4ldw_A1e-153840417355Auxin response factor 1
4ldv_A1e-153840417355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413489.10.0hypothetical protein EUTSA_v10024554mg
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A087GGF10.0A0A087GGF1_ARAAL; Auxin response factor
STRINGAT4G23980.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9